PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0065100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 319aa    MW: 35334.2 Da    PI: 7.5021
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0065100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.1e-163582148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd ll   v++ G g W+t +r+ g+ R++k+c++rw +yl
   Spipo2G0065100 35 RGPWTPEEDALLSSFVRREGEGKWRTLPRRAGLLRCGKSCRLRWMNYL 82
                     89******************************99************97 PP

2Myb_DNA-binding47.34.7e-1593133648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
   Spipo2G0065100  93 PDEEDLILRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 133
                      89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.013082IPR017930Myb domain
SuperFamilySSF466894.03E-2832129IPR009057Homeodomain-like
SMARTSM007171.6E-113484IPR001005SANT/Myb domain
PfamPF002491.0E-133582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-203689IPR009057Homeodomain-like
CDDcd001671.28E-93782No hitNo description
PROSITE profilePS5129424.85183137IPR017930Myb domain
SMARTSM007171.4E-1387135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2490138IPR009057Homeodomain-like
CDDcd001676.15E-1293133No hitNo description
PfamPF002499.3E-1493133IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MRNPSPAAAS GSWSETPASG RPKVLPGRGQ VGLKRGPWTP EEDALLSSFV RREGEGKWRT  60
LPRRAGLLRC GKSCRLRWMN YLRPSVKRGQ IAPDEEDLIL RLHRLLGNRW SLIAGRLPGR  120
TDNEIKNYWN THLSKKLISQ GIDPRTHKPL NTDNPSSSLQ NDHAEAPPAP AVYPNPNPNP  180
NPNPKPPTRL QNSGGLNSTL HIREDACDFF DGANQDQRSA WQNFDDSSSG RTLPNQYVQN  240
DIEYCSDDLF ASFLNSLISD DVFQQNPPND LISPLAPLAS EGHGFGNQAF WEPTPVVYST  300
TFIDKNYNAQ PTDGDCAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25331375108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276363.11e-103PREDICTED: transcription repressor MYB5-like
SwissprotQ388502e-77MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A0A0R6215e-96A0A0A0R621_PAESU; MYB transcription factor
STRINGVIT_08s0007g07230.t011e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.18e-77myb domain protein 5